PIWIL3 Antibody
| Name | PIWIL3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31855 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | Simple Western IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SRTSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDGDANSYIDTLRKYTRPTLQMVICILPNDDKRRYDSI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PIWIL3 Protein |
| Description | Rabbit Polyclonal |
| Gene | PIWIL3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PIWIL3 Antibody [NBP2-31855] - Staining of human stomach, upper shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12517_PIWIL3-Antibody-Immunohistochemistry-Paraffin-NBP2-31855-img0007.jpg)
Immunohistochemistry-Paraffin: PIWIL3 Antibody [NBP2-31855] - Staining of human stomach, upper shows strong membranous positivity in glandular cells.
![Simple Western: PIWIL3 Antibody [NBP2-31855] - Simple Western lane view shows a specific band for PIWIL3 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12518_PIWIL3-Antibody-Simple-Western-NBP2-31855-img0005.jpg)
Simple Western: PIWIL3 Antibody [NBP2-31855] - Simple Western lane view shows a specific band for PIWIL3 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: PIWIL3 Antibody [NBP2-31855] - Electropherogram image(s) of corresponding Simple Western lane view. PIWIL3 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12519_PIWIL3%2520Antibody-Simple%2520Western-NBP2-31855-img0006.jpg)
Simple Western: PIWIL3 Antibody [NBP2-31855] - Electropherogram image(s) of corresponding Simple Western lane view. PIWIL3 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).