![Immunohistochemistry-Paraffin: PIWIL3 Antibody [NBP2-31855] - Staining of human stomach, upper shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/PIWIL3-Antibody-Immunohistochemistry-Paraffin-NBP2-31855-img0007.jpg "Immunohistochemistry-Paraffin: PIWIL3 Antibody [NBP2-31855] - Staining of human stomach, upper shows strong membranous positivity in glandular cells.")
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SRTSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDGDANSYIDTLRKYTRPTLQMVICILPNDDKRRYDSI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PIWIL3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB reported in reported in scientific literature (PMID: 30701019). In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Simple Western: PIWIL3 Antibody [NBP2-31855] - Simple Western lane view shows a specific band for PIWIL3 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/PIWIL3-Antibody-Simple-Western-NBP2-31855-img0005.jpg "Simple Western: PIWIL3 Antibody [NBP2-31855] - Simple Western lane view shows a specific band for PIWIL3 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: PIWIL3 Antibody [NBP2-31855] - Electropherogram image(s) of corresponding Simple Western lane view. PIWIL3 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://images.novusbio.com/fullsize/PIWIL3-Antibody-Simple-Western-NBP2-31855-img0006.jpg "Simple Western: PIWIL3 Antibody [NBP2-31855] - Electropherogram image(s) of corresponding Simple Western lane view. PIWIL3 antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).")
