Human Calcium Pump PMCA4 ATPase protein fragment
| Name | Human Calcium Pump PMCA4 ATPase protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114628 |
| Category | Protein |
| Prices | $420.00 |
| Sizes | 10 µg |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P23634 |
| Gene | ATP2B4 |
| Residue | 1 to 92 |
| Sequence | MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGG VQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT* |
| Supplier Page | Shop |
Product images
ab114628 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.