Recombinant Human YY1

Name Recombinant Human YY1
Supplier Creative Biomart
Catalog YY1-31565TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P25490
Gene YY1
Sequence VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
Description Recombinant fragment amino acids 221-320 of Human YY1 with a proprietary tag at N-terminal: predicted molecular weight 36.63 kDa.
Supplier Page Shop