Recombinant Human MEIS1

Name Recombinant Human MEIS1
Supplier Creative Biomart
Catalog MEIS1-29559TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession O00470
Gene MEIS1
Sequence MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALI
Description Recombinant fragment corresponding to amino acids 1-90 of Human MEIS1 with a proprietary tag; Predicted MWt 35.53 kDa including tag.
Supplier Page Shop