Recombinant Human MC4R

Name Recombinant Human MC4R
Supplier Creative Biomart
Catalog MC4R-29453TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P32245
Gene MC4R
Sequence MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQ
Description Recombinant fragment corresponding to amino acids 1-43 of Human MC4 Receptor with a proprietary tag; Predicted MWt 30.36 kDa including tag.
Supplier Page Shop