Recombinant Human ID4

Name Recombinant Human ID4
Supplier Creative Biomart
Catalog ID4-28592TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P47928
Gene ID4
Sequence PALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALET
Description Recombinant fragment corresponding to amino acids 60-110 of Human ID4with a proprietary tag, predicted MWt 31 kDa
Supplier Page Shop