Pig IL8 full length protein

Name Pig IL8 full length protein
Supplier Abcam
Catalog ab60259
Category Protein
Applications SDS-PAGE FA
Species Reactivities Pig
Nature Recombinant
Source E. coli
Purity > 95 % by SDS-PAGE. Recombinant pig IL8 was purified via sequential chromatography and filtered prior to lyophilization through a 0.22 micron sterile filter. Endotoxin: <0.1 ng/µg.
SwissProt/Accession P10145
Gene CXCL8
Sequence ARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKE VCLDPKEKWVQKVVQIFLKRTEKQQQQQ
Supplier Page Shop