| Name | Recombinant Human CDH2 |
|---|---|
| Supplier | Creative Biomart |
| Catalog | CDH2-28769TH |
| Category | Protein |
| Nature | Recombinant |
| Source | Wheat germ |
| Purity | Proprietary Purification |
| SwissProt/Accession | P19022 |
| Gene | CDH2 |
| Sequence | RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD |
| Description | Recombinant fragment (amino acids 807-906) of Human N Cadherin with proprietary 26 kDa tag; 100 amino acids (Predicted MW 10.80 kDa), 36.63 kDa inclusive of tag. |
| Supplier Page | Shop |