| Name | Active mouse TWEAKR protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab157284 |
| Category | Protein |
| Prices | $410.00 |
| Sizes | 50 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Binds Human and mouse TWEAK. Inhibits TWEAK-mediated killing of Kym-1 target cells. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | Q9NP84 |
| Gene | TNFRSF12A |
| Residue | 1 to 75 |
| Sequence | MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM DCASCPARPHSDFCLGCAAAPPAHF |
| Supplier Page | Shop |