| Name | Active mouse Macrophage Inflammatory Protein 3 beta full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab168015 |
| Category | Protein |
| Prices | $883.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE HPLC FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. Purity is >98% by SDS-PAGE and HPLC analyses. |
| Bioactivity | Determined by its ability to chemoattract Human mature dendritic cells using a concentration of 10-100 ng/ml. |
| SwissProt/Accession | Q99731 |
| Gene | CCL19 |
| Residue | 26 to 108 |
| Sequence | GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLC APPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS |
| Supplier Page | Shop |