Active mouse BAFF full length protein
| Name | Active mouse BAFF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab157285 |
| Category | Protein |
| Prices | $465.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | DDDDK tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Binds to Human (weak) and mouse BCMA, TACI and BAFF-R. Mediates splenocyte survival. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | Q9Y275 |
| Gene | TNFSF13B |
| Residue | 127 to 309 |
| Sequence | AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIAD SDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYT DPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIAR LEEGDEIQLAIPRENAQISRNGDDTFFGALKLL |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis: Lane 1: MWt Marker, Lane 2: 1 µg ab157285, stained with Imperial stain
ab157285 mediates survival of freshly isolated splenocytes. Method: On day 0 splenocytes were isolated from a freshly collected C57Bl6 spleen. An aliquot of the splenocytes was analyzed on FACS and gated on the SSC-FSC panel. FACS settings were saved. The rest of the cells was put in culture with media alone or with increasing concentrations of ab157285 as indicated. After three days in culture, cells were harvested and analyzed on FACS with the saved setting. Splenocytes Survival Index (ratio % living/% dead cells) was calculated and plotted.