| Name | Active human TWEAKR protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab201431 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 5 µg |
| Applications | SDS-PAGE FA HPLC |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . > 95 % by HPLC. |
| Bioactivity | Fully biologically active when compared to standard. The ED 50 as determined by inhibiting TWEAK-dependent proliferation of Human umbilical vein endothelial cells (HUVEC) is less than 30 ng/ml, corresponding to a specific activity of > 3.3 × 10 4 IU/mg, in the presence of 15 ng/ml of TWEAKR. |
| SwissProt/Accession | Q9NP84 |
| Gene | TNFRSF12A |
| Residue | 28 to 80 |
| Sequence | EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRL LWP |
| Supplier Page | Shop |