Active human TWEAKR protein fragment
| Name | Active human TWEAKR protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab182702 |
| Category | Protein |
| Prices | $536.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to bind CD155 in a functional ELISA. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | Q9NP84 |
| Gene | TNFRSF12A |
| Residue | 28 to 79 |
| Sequence | EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRL LW |
| Supplier Page | Shop |
Product images
The purity of Human TWEAKR protein fragment was determined by DTT-reduced (1) and non-reduced (2) SDS-PAGE and staining overnight with Coomassie Blue. Human TWEAKR protein fragment fused with Fc fragment of Human IgG1 at the N-terminus, has a calculated MW of 33 kDa. The predicted N-terminus is Glu 28. As a result of glycosylation, DTT-reduced Protein migrates as 32-40 kDa and non-reduced protein migrates as 65-80 kDa.