Active human S100 beta full length protein
| Name | Active human S100 beta full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab200489 |
| Category | Protein |
| Prices | $500.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its ability to bind human AGER in a functional ELISA. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P04271 |
| Gene | S100B |
| Residue | 1 to 92 |
| Sequence | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE QEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Supplier Page | Shop |
Product images
DTT reduced SDS-PAGE analysis of ab200489 with staining overnight with Coomassie Blue. DTT-reduced protein migrates as 11 kDa in SDS-PAGE .