Human PD-L1 protein fragment
| Name | Human PD-L1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112410 |
| Category | Protein |
| Applications | ELISA Array WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | This product is useful for Antibody Production and Protein Array |
| SwissProt/Accession | Q9NZQ7 |
| Gene | CD274 |
| Residue | 141 to 240 |
| Sequence | ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKL FNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE image, using ab112410. (Stained with Coomassie Blue).