Human Nicotinic Acetylcholine Receptor alpha 1 protein fragment
| Name | Human Nicotinic Acetylcholine Receptor alpha 1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114482 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P02708 |
| Gene | CHRNA1 |
| Residue | 171 to 256 |
| Sequence | SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGE WVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab114482 at approximately 35.09kDa stained with Coomassie Blue.