Human MC4 Receptor protein fragment
| Name | Human MC4 Receptor protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112318 |
| Category | Protein |
| Applications | ELISA WB SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P32245 |
| Gene | MC4R |
| Residue | 1 to 43 |
| Sequence | MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQ |
| Supplier Page | Shop |
Product images
ab112318 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.