Human Macrophage Inflammatory Protein 1 alpha / CCL3 full length protein
| Name | Human Macrophage Inflammatory Protein 1 alpha / CCL3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab106871 |
| Category | Protein |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 90 % by SDS-PAGE. ab106871 is purifed by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P10147 |
| Gene | CCL3 |
| Residue | 24 to 92 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFE TSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of 3µg ab106871. Note: Molecular weight on SDS-PAGE will appear higher.