| Name | Active human MIP 1 alpha full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab192133 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 20 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Determined by its ability to chemoattract Human monocytes using a concentration range of 1.0-10.0 ng/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P10147 |
| Gene | CCL3 |
| Residue | 24 to 92 |
| Sequence | SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVC ADPSEEWVQKYVSDLELSA |
| Supplier Page | Shop |