| Name | Active dog IL8 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab200269 |
| Category | Protein |
| Prices | $107.00 |
| Sizes | 5 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Dog |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . ab200269 is > 95 % pure as assessed by SDS-PAGE and HPLC analyses. |
| Bioactivity | The biological activity was determined by a chemotaxis bioassay using Human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.15-0.75 ng/ml. |
| SwissProt/Accession | P10145 |
| Gene | CXCL8 |
| Residue | 23 to 101 |
| Sequence | AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFN GNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
| Supplier Page | Shop |