Human Hes1 protein fragment
| Name | Human Hes1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112302 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | Q14469 |
| Gene | HES1 |
| Residue | 201 to 280 |
| Sequence | APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTS NSGTSVGPNAVSPSSGPSLTADSMWRPWRN |
| Supplier Page | Shop |
Product images
112302 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.