CTCF Recombinant Protein (OPCA02634)

Name CTCF Recombinant Protein (OPCA02634)
Supplier Aviva Systems Biology
Catalog OPCA02634
Category Protein
Prices $250.00
Sizes 50 µg
Nature Recombinant
Source Human
Tag/Conjugation His-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession P49711
Gene CTCF
Sequence MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPT
Description This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.