Name | Anti-Ceramide synthase 1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab98062 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Horse |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 300-349 ( LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR ) of Human LASS1 (NP_067090) |
Description | Rabbit Polyclonal |
Gene | CERS1 |
Conjugate | Unconjugated |
Supplier Page | Shop |