SERPINB1 antibody

Name SERPINB1 antibody
Supplier Fitzgerald
Catalog 70R-4130
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SERPINB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL
Purity/Format Affinity purified
Blocking Peptide SERPINB1 Blocking Peptide
Description Rabbit polyclonal SERPINB1 antibody
Gene SERPINB1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.