| Name | WNT5A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6956 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | WNT5A antibody was raised using the middle region of WNT5A corresponding to a region with amino acids GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
| Purity/Format | Affinity purified |
| Blocking Peptide | WNT5A Blocking Peptide |
| Description | Rabbit polyclonal WNT5A antibody raised against the middle region of WNT5A |
| Gene | WNT5A |
| Supplier Page | Shop |