CHST2 antibody

Name CHST2 antibody
Supplier Fitzgerald
Catalog 70R-6854
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen CHST2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Purity/Format Affinity purified
Blocking Peptide CHST2 Blocking Peptide
Description Rabbit polyclonal CHST2 antibody
Gene CHST1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.