| Name | PPP5C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5672 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PPP5C antibody was raised using the N terminal of PPP5C corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPP5C Blocking Peptide |
| Description | Rabbit polyclonal PPP5C antibody raised against the N terminal of PPP5C |
| Gene | PPP5C |
| Supplier Page | Shop |