Anti-ACSL5 antibody
| Name | Anti-ACSL5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab104892 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 470-519 ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG of Human ACSL5 (NP_976313) |
| Description | Rabbit Polyclonal |
| Gene | ACSL5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
