Name | MOCS2 Antibody (4H3) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00004338-M05 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG1 Kappa |
Clone | 4H3 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | MOCS2 (NP_789776.1, 1 a.a. - 88 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | MOCS2 |
Conjugate | Unconjugated |
Supplier Page | Shop |