RPA4 Antibody

Name RPA4 Antibody
Supplier Novus Biologicals
Catalog NBP1-58156
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RPA4(replication protein A4, 34kDa) The peptide sequence was selected from the middle region of RPA4. Peptide sequence VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RPA4
Conjugate Unconjugated
Supplier Page Shop

Product images