PI 3-Kinase p110 delta Antibody
| Name | PI 3-Kinase p110 delta Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38535 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PI 3-Kinase p110 delta Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CLSTN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Lane 1: Marker [kDa] 250,130,100,70,55,35,25,15,10. Lane 2: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13516_PI-3-Kinase-p110-delta-Antibody-Western-Blot-NBP2-38535-img0006.jpg)
![Immunohistochemistry: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human appendix shows moderate cytoplasmic positivity in lymphoid cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/13517_PI%25203-Kinase%2520p110%2520delta%2520Antibody-Immunohistochemistry-NBP2-38535-img0001.jpg)