RPA4 Antibody

Name RPA4 Antibody
Supplier Novus Biologicals
Catalog NBP1-58157
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RPA4(replication protein A4, 34kDa) The peptide sequence was selected from the C terminal of RPA4. Peptide sequence HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RPA4
Conjugate Unconjugated
Supplier Page Shop

Product images