Name | RASGRP2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58871 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Pig, Dog, Rabbit |
Antigen | Synthetic peptides corresponding to RASGRP2(RAS guanyl releasing protein 2 (calcium and DAG-regulated)) The peptide sequence was selected from the N terminal of RASGRP2. Peptide sequence LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | RASGRP2 |
Supplier Page | Shop |