RASGRP2 Antibody

Name RASGRP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-58871
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Pig, Dog, Rabbit
Antigen Synthetic peptides corresponding to RASGRP2(RAS guanyl releasing protein 2 (calcium and DAG-regulated)) The peptide sequence was selected from the N terminal of RASGRP2. Peptide sequence LVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQVKTCHLVRYWIS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RASGRP2
Supplier Page Shop

Product images