BCMO1 Antibody
| Name | BCMO1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91698 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASDCHGAPLT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BCMO1 Protein |
| Description | Rabbit Polyclonal |
| Gene | BCO1 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: BCMO1 Antibody [NBP1-91698] - Staining of human cell line A-431 shows positivity in centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24467_BCMO1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91698-img0004.jpg)
![Immunohistochemistry-Paraffin: BCMO1 Antibody [NBP1-91698] - Staining of human rectum shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/24468_BCMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-91698-img0005.jpg)