DOC2B Antibody
| Name | DOC2B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13930 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKKLKPNHTKTFSICLEKQLPVDKTEDKSLEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DOC2B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DOC2B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DOC2B Antibody [NBP2-13930] Staining of human cell line U-251 MG shows positivity in cytoskeleton (microtubules).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11959_DOC2B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13930-img0002.jpg)
Immunocytochemistry/Immunofluorescence: DOC2B Antibody [NBP2-13930] Staining of human cell line U-251 MG shows positivity in cytoskeleton (microtubules).
![Immunohistochemistry-Paraffin: DOC2B Antibody [NBP2-13930] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11960_DOC2B%2520Antibody-Immunohistochemistry-Paraffin-NBP2-13930-img0001.jpg)
Immunohistochemistry-Paraffin: DOC2B Antibody [NBP2-13930] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.