STK32A Antibody

Name STK32A Antibody
Supplier Novus Biologicals
Catalog NBP1-82735
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP
Purity/Format Immunogen affinity purified
Blocking Peptide STK32A Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene STK32A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.