STK32A Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: HIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRFSQLSDVQNFPYMNDINWDAVFQKRLIPGFIP |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
STK32A |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (84%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for STK32A Antibody - BSA Free
Background
Sprouty was originally identified as an inhibitor of Drosophila epidermal growth factor (EGF) and fibroblast growth factor (FGF) receptor signaling during tracheal development. Four isoforms of mammalian sprouty are known (Spry1-Spry4). The role of the mammalian analogs has not been clearly elucidated although it is believed that human Sprouty 2 (hSpry2) may be an inhibitor of cellular migration and proliferation. Spry2 and Spry4 show considerable sequence homology between human and mouse at the C terminus of the protein. Significant sequence divergence occurs at the N terminus. Spry2 appears to be abundant in brain, lung and heart tissue, with lesser amounts found in kidney and skeletal muscle.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for STK32A Antibody (NBP1-82735) (0)
There are no publications for STK32A Antibody (NBP1-82735).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STK32A Antibody (NBP1-82735) (0)
There are no reviews for STK32A Antibody (NBP1-82735).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for STK32A Antibody (NBP1-82735) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional STK32A Products
Research Areas for STK32A Antibody (NBP1-82735)
Find related products by research area.
|
Blogs on STK32A
![Immunohistochemistry-Paraffin: STK32A Antibody [NBP1-82735] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/STK32A-Antibody-Immunohistochemistry-Paraffin-NBP1-82735-img0005.jpg "Immunohistochemistry-Paraffin: STK32A Antibody [NBP1-82735] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")