PMM1/Phosphomannomutase 1 Antibody
| Name | PMM1/Phosphomannomutase 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55475 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Guinea Pig |
| Antigen | Synthetic peptides corresponding to PMM1/Phosphomannomutase 1. The peptide sequence was selected from the N terminal of PMM1/Phosphomannomutase 1. Peptide sequence MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PMM1 |
| Supplier Page | Shop |
Product images
![Western Blot: PMM1/Phosphomannomutase 1 Antibody [NBP1-55475] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9609_PMM1-Phosphomannomutase%25201%2520Antibody-Western%2520Blot-NBP1-55475-img0002.jpg)
Western Blot: PMM1/Phosphomannomutase 1 Antibody [NBP1-55475] - 293T cells lysate, concentration 0.2-1 ug/ml.