Dehydrodolichyl Diphosphate Synthase Antibody
| Name | Dehydrodolichyl Diphosphate Synthase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55231 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DHDDS(dehydrodolichyl diphosphate synthase) The peptide sequence was selected from the N terminal of DHDDS. Peptide sequence NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DHDDS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-55231] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14812_Dehydrodolichyl%2520Diphosphate%2520Synthase%2520Antibody-Western%2520Blot-NBP1-55231-img0002.jpg)
Western Blot: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-55231] - Human Placenta lysate, concentration 0.2-1 ug/ml.