Calsyntenin-1 Antibody

Name Calsyntenin-1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59862
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLSTN1(calsyntenin 1) Antibody(against the N terminal of CLSTN1. Peptide sequence KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLSTN1
Conjugate Unconjugated
Supplier Page Shop

Product images