COPG Antibody

Name COPG Antibody
Supplier Novus Biologicals
Catalog NBP1-57624
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to COPG (coatomer protein complex, subunit gamma) The peptide sequence was selected from the N terminal of COPG)(50ug). Peptide sequence MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene COPG1
Conjugate Unconjugated
Supplier Page Shop

Product images