LASS1 Antibody
| Name | LASS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59733 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LASS1(LAG1 homolog, ceramide synthase 1) The peptide sequence was selected from the middle region of LASS1 (NP_067090). LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CERS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: LASS1 Antibody [NBP1-59733] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6981_LASS1-Antibody-Western-Blot-NBP1-59733-img0004.jpg)
![Western Blot: LASS1 Antibody [NBP1-59733] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6982_LASS1%2520Antibody-Western%2520Blot-NBP1-59733-img0003.jpg)