MUPP1 Antibody
| Name | MUPP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54331 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MPDZ(multiple PDZ domain protein) The peptide sequence was selected from the middle region of MPDZ. Peptide sequence DEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MPDZ |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MUPP1 Antibody [NBP1-54331] - Hela, 293T cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14728_MUPP1-Antibody-Western-Blot-NBP1-54331-img0001.jpg)
Western Blot: MUPP1 Antibody [NBP1-54331] - Hela, 293T cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-54331] - Human Kidney tissue, 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14729_MUPP1-Antibody-Immunohistochemistry-Paraffin-NBP1-54331-img0002.jpg)
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-54331] - Human Kidney tissue, 5 ug/ml.
![Western Blot: MUPP1 Antibody [NBP1-54331] - Lanes: Lane 1 : 30ug of HeLa cell lysate Lane 2: 30ug of 293T cell lysate Primary, Antibody Dilution: 1 : 2000 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: MPDZ.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14730_MUPP1%2520Antibody-Western%2520Blot-NBP1-54331-img0003.jpg)
Western Blot: MUPP1 Antibody [NBP1-54331] - Lanes: Lane 1 : 30ug of HeLa cell lysate Lane 2: 30ug of 293T cell lysate Primary, Antibody Dilution: 1 : 2000 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: MPDZ.