DDAH2 Antibody
| Name | DDAH2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58859 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DDAH2(dimethylarginine dimethylaminohydrolase 2) The peptide sequence was selected from the N terminal of DDAH2 (NP_039268). Peptide sequence MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG. |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DDAH2 Blocking Peptide |
| Description | Rabbit Polyclonal |
| Gene | DDAH2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DDAH2 Antibody [NBP1-58859] - Titration: 1 ug/ml Positive Control: Fetal Brain Lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29849_DDAH2-Antibody-Western-Blot-NBP1-58859-img0005.jpg)
Western Blot: DDAH2 Antibody [NBP1-58859] - Titration: 1 ug/ml Positive Control: Fetal Brain Lysate.
![Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus Tissue, 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29850_DDAH2-Antibody-Immunohistochemistry-Paraffin-NBP1-58859-img0004.jpg)
Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus Tissue, 5.0ug/ml.
![Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29851_DDAH2-Antibody-Immunohistochemistry-Paraffin-NBP1-58859-img0002.jpg)
Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.
![Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29852_DDAH2-Antibody-Immunohistochemistry-Paraffin-NBP1-58859-img0003.jpg)
Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.