NIFK Antibody (CL2240)

Name NIFK Antibody (CL2240)
Supplier Novus Biologicals
Catalog NBP2-36749
Prices $419.00
Sizes 100 µl
Host Mouse
Clonality Monoclonal
Isotype IgG2a
Clone CL2240
Applications ICC/IF IHC
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Purity/Format Protein A purified
Description Mouse Monoclonal
Gene NIFK
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.