ABCG2/CD338 Antibody
| Name | ABCG2/CD338 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59749 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Goat, Pig, Rabbit, Sheep, Zebrafish |
| Antigen | Synthetic peptides corresponding to ABCG2(ATP-binding cassette, sub-family G (WHITE), member 2) The peptide sequence was selected from the N terminal of ABCG2 (NP_004818). Peptide sequence SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP. |
| Description | Rabbit Polyclonal |
| Gene | ABCG2 |
| Supplier Page | Shop |
Product images
![Western Blot: ABCG2 Antibody [NBP1-59749] - Titration: 2.5 ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/15331_ABCG2%2520Antibody-Western%2520Blot-NBP1-59749-img0003.jpg)
Western Blot: ABCG2 Antibody [NBP1-59749] - Titration: 2.5 ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: ABCG2 Antibody [NBP1-59749] - Human Placenta Decidual cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/15332_ABCG2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59749-img0002.jpg)
Immunohistochemistry-Paraffin: ABCG2 Antibody [NBP1-59749] - Human Placenta Decidual cells (indicated with arrows), 4-8ug/ml.
![Simple Western: ABCG2/CD338 Antibody [NBP1-59749] - Simple Western lane view shows a specific band for ABCG2 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/15333_ABCG2-CD338-Antibody-Simple-Western-NBP1-59749-img0004.jpg)
Simple Western: ABCG2/CD338 Antibody [NBP1-59749] - Simple Western lane view shows a specific band for ABCG2 in 0.5 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.