ACSL5 Antibody
| Name | ACSL5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59645 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptides corresponding to ACSL5(acyl-CoA synthetase long-chain family member 5) The peptide sequence was selected from the C terminal of ACSL5. Peptide sequence ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ACSL5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21148_ACSL5-Antibody-Western-Blot-NBP1-59645-img0004.jpg)
Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.
![Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - Human skeletal muscle tissue at an antibody concentration of 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21149_ACSL5%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59645-img0003.jpg)
Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - Human skeletal muscle tissue at an antibody concentration of 4-8ug/ml.
![Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21150_ACSL5%2520Antibody-Western%2520Blot-NBP1-59645-img0001.jpg)
Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate at a concentration of 1ug/ml.