PSMC3IP Antibody

Name	PSMC3IP Antibody
Supplier	Novus Biologicals
Catalog	NBP1-92301
Prices	$129.00, $419.00
Sizes	25 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Applications	WB Simple Western ICC/IF IHC IHC-P
Species Reactivities	Human, Rat
Antigen	This antibody was developed against Recombinant Protein corresponding to amino acids:PEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPD
Purity/Format	Immunogen affinity purified
Blocking Peptide	PSMC3IP Protein
Description	Rabbit Polyclonal
Gene	PSMC3IP
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: PSMC3IP Antibody [NBP1-92301] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: PSMC3IP Antibody [NBP1-92301] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: PSMC3IP Antibody [NBP1-92301] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

Western Blot: PSMC3IP Antibody [NBP1-92301] - Analysis in human testis tissue.

Simple Western: PSMC3IP Antibody [NBP1-92301] - Simple Western lane view shows a specific band for PSMC3IP in 0.5 mg/ml of Human Testis (left) and Mouse Testis (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: PSMC3IP Antibody [NBP1-92301] - Simple Western lane view shows a specific band for PSMC3IP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: PSMC3IP Antibody [NBP1-92301] - Electropherogram image(s) of corresponding Simple Western lane view. PSMC3IP antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).