Name | NPAT Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP2-58659 |
Prices | $419.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | ICC/IF |
Species Reactivities | Human |
Antigen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VNQAVSPNFSQGSAIIIASPVQPVLQGMVGMIPVSVVGQNGNNFSTPPRQVLHMPLTAPVCNRSIPQFPVPPKSQKAQGLRNKPCIGKQVNNLVDSSGHSV |
Purity/Format | Affinity purified |
Blocking Peptide | NPAT Recombinant Protein Antigen |
Description | Rabbit Polyclonal |
Gene | NPAT |
Conjugate | Unconjugated |
Supplier Page | Shop |